Protein Info for ABZR87_RS11600 in Ralstonia sp. UNC404CL21Col

Annotation: aspartate/glutamate racemase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF01177: Asp_Glu_race" amino acids 3 to 209 (207 residues), 207 bits, see alignment E=1.5e-65

Best Hits

Swiss-Prot: 49% identical to HYDRA_PSESN: Hydantoin racemase (hyuE) from Pseudomonas sp. (strain NS671)

KEGG orthology group: K01797, [EC: 5.1.99.-] (inferred from 99% identity to rpf:Rpic12D_1297)

MetaCyc: 56% identical to allantoin racemase monomer (Klebsiella pneumoniae)

Predicted SEED Role

"Hydantoin racemase (EC 5.1.99.-)" in subsystem Hydantoin metabolism (EC 5.1.99.-)

Isozymes

Compare fitness of predicted isozymes for: 5.1.99.-

Use Curated BLAST to search for 5.1.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>ABZR87_RS11600 aspartate/glutamate racemase family protein (Ralstonia sp. UNC404CL21Col)
MNIRIINPNTTTSMTALIGRCAQAAAASGTRITAVSPKMGPASIESHYDEALSVPGILEE
IRHGERDGADAYVIACFGDPGLYAARELAHGPVIGIAEAAMHMASLIGNSFSVVTTLERT
VGMAWHLAERYGMRHACRNVHASDLPVLDLEKPGSNARQIILEACRSALAQDRSDCIVLG
CAGMADLCEDLSAELHVPVIDGVVAAVKLVEALVGMRLSTSKRGDWARPLPKPYTGMLAP
FALA