Protein Info for ABZR87_RS11540 in Ralstonia sp. UNC404CL21Col

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 224 to 229 (6 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 16 to 277 (262 residues), 334.4 bits, see alignment E=5.3e-104 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 18 to 281 (264 residues), 430.4 bits, see alignment E=2.9e-133 PF00528: BPD_transp_1" amino acids 84 to 282 (199 residues), 79.3 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 55% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 98% identity to rpi:Rpic_1221)

MetaCyc: 55% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ABZR87_RS11540 sulfate ABC transporter permease subunit CysT (Ralstonia sp. UNC404CL21Col)
MSLPSAFFSSKRRKPANVLPGFGLALGFSLLYLALIVLIPLSATVLKTFTMTWDAFWTTV
TAPRVVASYKLTFGASLIAAVINLVFGLIVAWVLVRYRFPGKRLIDALVDLPFALPTAVA
GIALTALYAPNGWIGSRLEPLGLKVAFTPLGIVVALTFIGLPFVVRTVQPVLEDLEAELE
EAAASLGATRWQTFTRVILPTLLPALLTGFALAFARATGEYGSVIFIAGNMPMVSEITPL
MIYSKLEQFDYAGATAIAVVMLGISFTLLLVINLLQAWTRRRGNRNDAIERAPEPPTANA
AAGA