Protein Info for ABZR87_RS11430 in Ralstonia sp. UNC404CL21Col

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 122 to 138 (17 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 209 (34 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details PF02366: PMT" amino acids 22 to 247 (226 residues), 49.9 bits, see alignment E=5e-17 PF13231: PMT_2" amino acids 73 to 235 (163 residues), 52.8 bits, see alignment E=8.4e-18 PF18583: Arnt_C" amino acids 453 to 555 (103 residues), 140.2 bits, see alignment E=2.7e-45

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_1199)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>ABZR87_RS11430 glycosyltransferase family 39 protein (Ralstonia sp. UNC404CL21Col)
MSIDRTAQAPTLPWRNASLWLLAAAFLAVWLGTLGYRHLIPTDEGRYAEIAREMFVSGDW
VTIRYNALKYFEKPPLQMWGTALAYTLFGIGDWQARLFTALSGIVGIVFTMLAAARWWGR
RTAVISGLVLASAPLWNVGSHFNSLDMGVAGCMTMALGSLLLAQHPNATRAQQRGWMWAC
WASMALAVLSKGLIGVVLPGFVLVVYTLVARDWALWKRLHLVTGLIIFFAVGAPWFVLIS
MRNPEFAWFFFVHEHFQRFTSTVHNRNAPFWYFVPLLVAGFLPWLAQLPGAARLTMARAE
TASNGFRPTLVLGLWAVLIFAFFSISDSKLPGYIFPIIPALAILAALVLEQTSERAWRWQ
LRAFLALALVGLAASGYVATMSSGMYPNAVFSRFAVFLAVAFAAGAAFTWLAIRLAGRRF
ESVVAFACAWFLTFTAAMLGHEAFGRSMSGIDLVPAVRPWLKPDVPFYAVERLDHTMPFY
LGRPTIMVQEPDELAFGVAQEPTKWVPTTEAFVARWKAGDQAVAMMGPGTYDRLTAQGVP
MIVIARDARRVIVRRN