Protein Info for ABZR87_RS11365 in Ralstonia sp. UNC404CL21Col

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00665: replicative DNA helicase" amino acids 15 to 452 (438 residues), 592.2 bits, see alignment E=3e-182 PF00772: DnaB" amino acids 15 to 116 (102 residues), 121.7 bits, see alignment E=1.9e-39 PF03796: DnaB_C" amino acids 195 to 450 (256 residues), 369.7 bits, see alignment E=1.1e-114 PF13481: AAA_25" amino acids 211 to 373 (163 residues), 48.9 bits, see alignment E=9.7e-17

Best Hits

Swiss-Prot: 55% identical to DNAB_ECOL6: Replicative DNA helicase (dnaB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to rpf:Rpic12D_1247)

MetaCyc: 55% identical to replicative DNA helicase (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12 or 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>ABZR87_RS11365 replicative DNA helicase (Ralstonia sp. UNC404CL21Col)
MNAPSDPQLDSLKVPPHSIEAEQSVLGGLLLDNAAWDRIADFINEHDFYRYDHRLIFHNI
GKLISQAKPADVITVYEQLQAAGKAEEVGGLAYLNALAQNTPSAANIRRYAEIVRDRGVL
RQLVTIADEISAGAFNPQGRDVRQLLDEAESKVFAIAEEGSRGQKGFLEIQPLLTQVVER
IDELYHRDNQSDITGVPTGFVDLDRMTSGMQGGDLIIVAGRPSMGKTAFSLNIGEHVAVE
QGLPVAVFSMEMAGTQLAMRMLGSVGRLDQHRLRTGRLLDEDWPRLTHAIQKMNDAQLFI
DETPALNPMELRARSRRLARQCGQLGLIVIDYLQLMSGSGGGENRATEISEISRSLKGLA
KELNCPVIALSQLNRSLEQRPNKRPVMSDLRESGAIEQDADVILFIYRDQVYNPDSPDKG
TAEIIIGKQRNGPIGTVRLTFLGEYTKFDNFTGGNAFFDNDT