Protein Info for ABZR87_RS11335 in Ralstonia sp. UNC404CL21Col

Annotation: ferredoxin--NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00970: FAD_binding_6
  • amino acids 16 to 98 (83 residues), 37.8 bits, E=2.1e-13
• PF00175: NAD_binding_1
  • amino acids 113 to 230 (118 residues), 29.5 bits, E=1e-10

Best Hits

Swiss-Prot: 77% identical to FENR_AZOVI: Ferredoxin--NADP reductase (fpr) from Azotobacter vinelandii

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 99% identity to rpi:Rpic_1180)

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (1/4 steps found)
• photosynthesis light reactions (1/4 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)

KEGG Metabolic Maps

• Photosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2

Protein Sequence (258 amino acids)

>ABZR87_RS11335 ferredoxin--NADP reductase (Ralstonia sp. UNC404CL21Col)
MSAFNQETVLSVHHWNDSLFSFKTTRDQALRFHNGHFVMIGLEVEGKPLMRAYSIASPNY
EEHLEFFSIKVQNGPLTSRLQHLKVGDKLLVSKKPVGTLVLDDLLPGKNLYLFGTGTGLA
PFMSIIQDPDTYERFEKVVLLHGVRQVSELAYADFITSELPNNEFFGDQVREKLIYYPTV
TREPFRNMGRLTDLVDSGKLSADIGLPPMDPAVDRAMICGSPAMLEDTCKLLDARGFKIS
PRMGEAGDYVIERAFVEK