Protein Info for ABZR87_RS11275 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 119 (106 residues), 56.9 bits, see alignment E=1.2e-19 PF00528: BPD_transp_1" amino acids 35 to 224 (190 residues), 60.7 bits, see alignment E=8.2e-21

Best Hits

Swiss-Prot: 34% identical to PATM_VIBHA: Probable amino-acid ABC transporter permease protein PatM (patM) from Vibrio harveyi

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 53% identity to bpa:BPP1799)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABZR87_RS11275 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MFDLSFLLEDGYLRLLRDGILTTLRLFVVSGLLAIAVGVSLATLRALPVRVFKAFVIVVV
EYHRNVPMLVQILVWYFGVPQLLPESLKAWINAGNTEFFFATIALALNSGAFISEDLRSG
LRAIPHTQQEAAWSIGLTHLQALRYVILPQAIRVALPALLNQALLLFKNSSLAMAIGVHE
LLYRTRQIDNLTFRTFDVFLIATLLYLLGTLALMALSERVAKRRTTPLGV