Protein Info for ABZR87_RS11235 in Ralstonia sp. UNC404CL21Col

Annotation: AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 35 to 491 (457 residues), 534.7 bits, see alignment E=9.8e-165 PF02321: OEP" amino acids 90 to 280 (191 residues), 78.3 bits, see alignment E=3.4e-26 amino acids 313 to 489 (177 residues), 81.7 bits, see alignment E=3e-27

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_1215)

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>ABZR87_RS11235 AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor (Ralstonia sp. UNC404CL21Col)
MNALNSAPQALSPQSRAGSTRAQWPARLGVALSAVMLAVLAGCANLGNSHSTQTLTTPDQ
LASAQSLPSQGGQWPSQSWVDQFNDPQLRALVDEAIKDNPNLQVAFARVRASRAMADVVR
GNLYPSVGLDADMTRQRLSEYDMFEGTPLAGRWFTESKIQLGVSYDLDFWGKNRSALEAA
LSDDKAMEAESQASRLMLSTTVARTYAKLAALYAQRDVAERAIVQRKDLTSLAGQRLRAG
LDTQVETTQARANVAAAQTELEQVDEQITLARNQLAALLGKGPDRGLAIARPTLLAQATP
KLPNNLTIDLIGRRPDLVAARWRVEAASKDIDVAKAQFLPDISLTAFLGLASIAPENLLL
GASRQLGIGPALKLPIFQGGKLRANLRGKYANYDAAVASYNQTLTEALHDTADQITALHS
IDAQIAIQRTALSEAERAYSLARTRYSAGLGTQLVVLNAETTVLQQRKLATDLQARRLDA
QMALIKALGGGYTAEDLPGAKPDAAASHG