Protein Info for ABZR87_RS11230 in Ralstonia sp. UNC404CL21Col

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details PF16576: HlyD_D23" amino acids 72 to 302 (231 residues), 43.9 bits, see alignment E=4.5e-15 PF13533: Biotin_lipoyl_2" amino acids 74 to 122 (49 residues), 28.8 bits, see alignment 2.1e-10 PF00529: CusB_dom_1" amino acids 143 to 359 (217 residues), 53.7 bits, see alignment E=4.1e-18 PF13437: HlyD_3" amino acids 233 to 351 (119 residues), 51.5 bits, see alignment E=3.6e-17

Best Hits

Swiss-Prot: 48% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 99% identity to rpf:Rpic12D_1214)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ABZR87_RS11230 HlyD family secretion protein (Ralstonia sp. UNC404CL21Col)
MSDNKPQAAPSAAPVPAAPAATPPGNGNANGKRKRMLTTLAAALVVAGVGYGLYWGLYGR
WFESTDDAYVQGNVVQVTPQVAGTVVAIRADDTQLVTSGQPVIELDRADARVALEQAEAA
LAQTVRQVRTLYSNTSAYTATLAMRESDLAKAKDDLARRKQIAGTGAVSQEEISHAQTAV
QAAQSALEAAKEQLQGNRVLTEQTTLERHPNVLQAAAKVREAYLAYARTSLPASVTGYVA
KRSVQVGQRVAPGTPLMAIVPLDQLWVDANFKEVQVRHMRVGQPVELVADVYGSSVTYHG
KVVGFSAGTGSAFSLLPAQNATGNWIKVVQRLPVRVSLDPKELKDHPLRVGLSMEAKVDI
HDEGGQSLATTPVASPLQTTVYDQAGKDADQVIASIISANAGRGGATAPAASNVPAVSAP
RTSQPAPKV