Protein Info for ABZR87_RS11180 in Ralstonia sp. UNC404CL21Col

Annotation: fumarate/nitrate reduction transcriptional regulator Fnr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00027: cNMP_binding" amino acids 44 to 127 (84 residues), 57.4 bits, see alignment E=1.8e-19 PF13545: HTH_Crp_2" amino acids 162 to 235 (74 residues), 68.3 bits, see alignment E=6.9e-23 PF00325: Crp" amino acids 187 to 218 (32 residues), 44.8 bits, see alignment 1.2e-15

Best Hits

Swiss-Prot: 61% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 98% identity to rpf:Rpic12D_1204)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABZR87_RS11180 fumarate/nitrate reduction transcriptional regulator Fnr (Ralstonia sp. UNC404CL21Col)
MLTRIALTDQASRCSTCVLGQICLPVGMNSDDVRKMDDLVGERIRIKKGQSLYALGEPLE
AVYGIRFGTLKTHLTLEDGRHQITGFHLPGEIVGLDGIGDMRHVSDATALEDTEVCVVRY
DELQQLSRRLPSLQHQFLRIMSKEISQDHLMLLTLGSMRAEERLAAFLLNLSKRSAQRGY
SSTEFVLRMSREELGSYLGLKLETVSRLFSRFAEAGLIQIRQRHVKLIDLAGLRQVMSGQ
AA