Protein Info for ABZR87_RS11135 in Ralstonia sp. UNC404CL21Col

Annotation: heavy metal translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 851 transmembrane" amino acids 209 to 229 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details amino acids 487 to 512 (26 residues), see Phobius details amino acids 805 to 823 (19 residues), see Phobius details amino acids 829 to 847 (19 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 36 to 120 (85 residues), 69.2 bits, see alignment E=1e-22 PF00403: HMA" amino acids 129 to 189 (61 residues), 48.6 bits, see alignment 2.2e-16 TIGR01525: heavy metal translocating P-type ATPase" amino acids 279 to 847 (569 residues), 487.2 bits, see alignment E=1.7e-149 TIGR01494: HAD ATPase, P-type, family IC" amino acids 315 to 573 (259 residues), 110.4 bits, see alignment E=1.6e-35 amino acids 656 to 822 (167 residues), 109.6 bits, see alignment E=2.7e-35 PF00122: E1-E2_ATPase" amino acids 342 to 520 (179 residues), 157.9 bits, see alignment E=4.9e-50 PF00702: Hydrolase" amino acids 539 to 758 (220 residues), 83.7 bits, see alignment E=6e-27 PF08282: Hydrolase_3" amino acids 734 to 780 (47 residues), 23.4 bits, see alignment 1.2e-08

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 92% identity to rpf:Rpic12D_1195)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (851 amino acids)

>ABZR87_RS11135 heavy metal translocating P-type ATPase (Ralstonia sp. UNC404CL21Col)
MTTTFAPIHPAAHPTAPVAGSGSPIGPSGAGASHATCYHCASPLDGASAVYADIAGTSRE
FCCAGCQAVAQTLHASGMGHVYDGPIAFAKPIEGDRRTEAEAVWATYDLPVMRERFVRKR
ADGAEELSLAISGMRCAACVWLIERALSQVPGIREATVNYATERARIVADAGAMRLSAVF
AAIADVGYEAWPDQPSARRTAEARERRSLLIRLGLAMLGMMQVMMYAWPVYLHGGDIPVS
QTRLMQWASLLLTVPVVLISARPIFINAWRQVRHGHVGMDVPVALGIGAAFVASVVATLR
GHGETYFDSVTMFVAFLLAARYLELRARQSAASGAEALVRQLPATCRRIDAESGALETIP
VATLQPGDCVEVRAGEVLPADGIIEHGTTEVDESLLSGESVPRPRDVGATVLAGSYNVVS
AIRVRVNRVGTQTRLAAIVDLLERALTDKPRMAELADRVAGRFVAVLLGWALLTAIAWWW
IEPTRMFAVTVAVLVVSCPCALSLATPSALAAASGALARRGVLVTRGHAIESLAAATDVL
LDKTGTLTEGRLRLLSIETFSDLDAEDCLALACAMEQSENHPIAQSLRAAASDAMPLPTL
GSVTNVPGQGVYAMTGHQLMRLGTQSFAARQYANHTITSTRYSTETPLEEVPPAAACTSV
WLGRNGEPLARFTLADTPRADAPACLSALRAQGLCLHLVSGDAPETVHWWANRLGIDHAV
GGASPEDKRAYVCKLQANGARVLAVGDGINDAPLLAQAQVSIAIGSGAPLAQAGADAILT
EPRLLAISEAVSIGHRTLRVVRQNLGWAFAYNAISIPLATLGWLSPLAAGIGMSVSSLLV
ALNAWRLSRAT