Protein Info for ABZR87_RS11005 in Ralstonia sp. UNC404CL21Col

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR00021: ribose 5-phosphate isomerase A" amino acids 12 to 223 (212 residues), 212.5 bits, see alignment E=2.4e-67 PF06026: Rib_5-P_isom_A" amino acids 53 to 221 (169 residues), 197.3 bits, see alignment E=7.6e-63

Best Hits

Swiss-Prot: 99% identical to RPIA_RALPJ: Ribose-5-phosphate isomerase A (rpiA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 99% identity to rpf:Rpic12D_1168)

MetaCyc: 61% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABZR87_RS11005 ribose-5-phosphate isomerase RpiA (Ralstonia sp. UNC404CL21Col)
MTQDELKALVAQAAADYVLANVPEGAVLGVGTGSTANLFIDAMAPHKARFAGAVSSSEAS
TRRLQGHGFTVLDLNEVDAIPVYVDGADEIDASGAMIKGGGGALTREKIVASVASVFVCI
ADGSKLVETMGAFPLPVEVVPMARAAVARQLAALGGQPRLRMTKEGQIYKTDNGNVILDV
TGLRIADPKGLESVVNDIPGVVTVGLFAKRGANVLLLGTEAGVQRRDF