Protein Info for ABZR87_RS10985 in Ralstonia sp. UNC404CL21Col

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 864 TIGR02063: ribonuclease R" amino acids 9 to 585 (577 residues), 703 bits, see alignment E=4.5e-215 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 63 to 743 (681 residues), 702 bits, see alignment E=7.2e-215 PF08206: OB_RNB" amino acids 76 to 133 (58 residues), 72.7 bits, see alignment 3.2e-24 PF17876: CSD2" amino acids 154 to 227 (74 residues), 87.3 bits, see alignment E=1.1e-28 PF00773: RNB" amino acids 249 to 580 (332 residues), 368.8 bits, see alignment E=5.4e-114 PF00575: S1" amino acids 659 to 740 (82 residues), 42.7 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 71% identity to bma:BMA1263)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (864 amino acids)

>ABZR87_RS10985 ribonuclease R (Ralstonia sp. UNC404CL21Col)
MNQPTYPIPSREEILGVLRTSGSPLSATDIAKALSVTRKEHDGFIKRLTAMERDGQIELN
RKGRYELAHQPNFIEGRVIGHRDGFGFFVRDDGEPDIFLPEREMQKAMHGDRALVRAVGY
DRRGRSEGQIVEILQRANKRVIGRLLSESGTLVVAPEDKRLGRDILIAPKGQGKAKVGQV
VSVEILEYPDRYVQPIGRVVEVLGEIDDPGMEIEIAVRKYGVPHEFSEPTQREAEALPDV
VRDADLAGRIDLRDVPLVTIDGEDARDFDDAVYAEPVKIGRSKGWRLIVAIADVSHYVRP
GHPLDADAIDRATSVYFPRRVIPMLPEKLSNGLCSLNPEVDRLCMVCDAVITAKGEIKAY
QFYPAVMHSKARLTYNEVWAILSNVKGPEAAKRAPLVPHLQELYELYQTLLKARRERGAI
DFDTTETYIVCNAQGKIEQILPRTRNDAHRLIEECMLTANVCAAEMLEKYKHPALYRVHA
GPTEEKLQALRAFLKTSGLTLGGGDKPQAADYAELMEKVAARPDAPMLQTMLLRSMQQAV
YSPDNIGHFGLAYPAYAHFTSPIRRYPDLLVHRSIKAILNRTRYVPALAPGVQLNSALSP
KARRLQAEAEKGVPAAVVNKAKVEAIWHELGVHCSANERRADEASRDVEAWLKCYFMRDK
LGNEFSGTVSAVTSFGIFVQLDELYVEGLVHVTELGSDYFQYDEARNELRGERTGIRYRL
TDRVRVQLLRVDLDARKMDFRLIQEPSTKALRPAKVTGAPEAAAARQAAVATPAPPVGRK
KPRQLAALLGGTAKPEESFDETLDRVIEEQPVFEPGGRALPPGHPHAKPARKKQAARGTK
PKGGAKTAAPRKVAGKAPRKTKGR