Protein Info for ABZR87_RS10965 in Ralstonia sp. UNC404CL21Col

Annotation: ATP phosphoribosyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF13393: tRNA-synt_His" amino acids 11 to 314 (304 residues), 416.8 bits, see alignment E=2.7e-129 TIGR00443: ATP phosphoribosyltransferase, regulatory subunit" amino acids 13 to 315 (303 residues), 283.9 bits, see alignment E=7.5e-89

Best Hits

Swiss-Prot: 98% identical to HISZ_RALPJ: ATP phosphoribosyltransferase regulatory subunit (hisZ) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K02502, ATP phosphoribosyltransferase regulatory subunit (inferred from 98% identity to rpi:Rpic_1069)

Predicted SEED Role

"ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABZR87_RS10965 ATP phosphoribosyltransferase regulatory subunit (Ralstonia sp. UNC404CL21Col)
MPTNWLLPESIADVLPSEARKIEELRRCMLDLFRTYGYELVMPPMLEYIESLLSGTGHDL
DLKTFKLVDQLSGRTIGLRADITPQVARIDAHLLNRAGVTRLCYAGSVLHTRPSGFHVTR
EPLQIGAEIYGHAGLEADLEIQELMLAALSAAGLADVRLDLCHVGVVAALLEQSPIAARI
QDDLFTALAAKDVPALRAITADLPAAQRDAINLLPALYGGVDVLALARKQLPALPAIGRA
LDDLATLAERAGGATVNIDLADLRGYHYHSGVMFAAYVAGVPNAVARGGRYDKVGEAFGR
ARPATGFSLDLREVAGISPVEARAAAIHAPWSGDAKLREAIAALRAAGEIVIQSLPGHPE
DLEEFAYDRQLVEEGGRWIVKPRNASI