Protein Info for ABZR87_RS10905 in Ralstonia sp. UNC404CL21Col

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 9 to 250 (242 residues), 268 bits, see alignment E=3.5e-84 PF13432: TPR_16" amino acids 50 to 113 (64 residues), 19.7 bits, see alignment E=7.5e-07 amino acids 86 to 142 (57 residues), 16.5 bits, see alignment E=7.4e-06 amino acids 128 to 185 (58 residues), 16.3 bits, see alignment E=8.7e-06 PF13414: TPR_11" amino acids 56 to 94 (39 residues), 27.6 bits, see alignment 1.5e-09 PF13181: TPR_8" amino acids 81 to 112 (32 residues), 23.2 bits, see alignment 4.1e-08 amino acids 152 to 184 (33 residues), 18.2 bits, see alignment 1.6e-06 PF13176: TPR_7" amino acids 87 to 115 (29 residues), 15.2 bits, see alignment (E = 1.5e-05) amino acids 155 to 185 (31 residues), 14 bits, see alignment 3.4e-05

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 98% identity to rpi:Rpic_1057)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>ABZR87_RS10905 type IV pilus biogenesis/stability protein PilW (Ralstonia sp. UNC404CL21Col)
MKRWSTAVSLVFTLAAAGCALSPPVQTQTREVTTVPDQKADAGRRAAIRLQLATQYLEAG
QNATALEEIKNAIAIDPNVPNAYHIRALAYMNLGQREQADESFRSALAATPQDGDLLNNY
GWFLCSQGGKPDQGMAMLRQAIEAPAAGSPAKPWTNLGVCQMRQGDLDGAEKSLTRATYI
DANNPLTNLTLAQLYYKRREYSRAMPFIERVNGRGNPTAESLWLGARVARRLGDTSQQNA
WSAQLQRRFPNAPEEAAFERGAWDD