Protein Info for ABZR87_RS10885 in Ralstonia sp. UNC404CL21Col

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05958: tRNA_U5-meth_tr
  • amino acids 264 to 448 (185 residues), 59.7 bits, E=2.7e-20
• PF13847: Methyltransf_31
  • amino acids 293 to 411 (119 residues), 29.1 bits, E=7.9e-11

Best Hits

Swiss-Prot: 96% identical to RLMD_RALPJ: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 97% identity to rpf:Rpic12D_1145)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (450 amino acids)

>ABZR87_RS10885 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Ralstonia sp. UNC404CL21Col)
MPVAGPLEIVSLDGEARGIGRLTNEDGSPGKVVFVEGALPGERVMYRSHRVKPSYEQASV
VDILRQSASRVTPQCKFFGVCGGCSMQHLDSRAQVAIKQRVLEDDLWHLAKLRPDVVFRP
IAGPDWGYRYRARLTVRHVAAKGGVLVGFHERKSSYVADMTSCEVLPPHVSALLVPLREL
VGRLSIVQRMPQIELAVGQDVTALVLRNLEPITAEDEAELRDFADQHNVQFWLQPKGPDT
VYPFHPLDRTLTYTLPEFGITMPFKPTDFTQVNHQINRVLMSRALKLLDAQPSDRLLDLF
CGIGNFTLPMATRAREVMGIEGSEALTTRALANAQHNGLDAKTTFACRNLFEVSADDIAA
LGKFDRWLIDPPREGALAVSKALAELSQRGGEAADLLPKRIVYVSCNPATLARDAGLLVH
EAGYRLAGAGVVNMFPHTSHVESMAVFERD