Protein Info for ABZR87_RS10875 in Ralstonia sp. UNC404CL21Col

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 94 to 377 (284 residues), 449.3 bits, see alignment E=6e-139 PF00140: Sigma70_r1_2" amino acids 104 to 137 (34 residues), 30.1 bits, see alignment 7.9e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 138 to 366 (229 residues), 117.4 bits, see alignment E=4.8e-38 PF04542: Sigma70_r2" amino acids 142 to 211 (70 residues), 78 bits, see alignment E=7.9e-26 PF04539: Sigma70_r3" amino acids 222 to 298 (77 residues), 48.4 bits, see alignment E=1.7e-16 PF04545: Sigma70_r4" amino acids 312 to 364 (53 residues), 59.7 bits, see alignment 3.2e-20

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 99% identity to rpf:Rpic12D_1143)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>ABZR87_RS10875 RNA polymerase sigma factor RpoS (Ralstonia sp. UNC404CL21Col)
MPRQKAATPVTPADDNIDAAVEGQRTPNGRAGRRARGAAQPPAKEIEVVDALVDDLPASD
SADLNDTSDSADEPDEEEEDGEEAEEPAPEEDFRKVLQAELAADTVQHYLNRISIKPLLT
PAEELHFSTLAKAGEFAARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIE
KFDPERGFRFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKSGVDG
RDASLEDIAHLLGKTTEEVQDVLSLNEHTTSLDTPFDLDPGTSLLDFLSDEHGASPDQEV
AHRELSLLMKSWLARLSDKHRYVVERRFGLNYIEPATLEELAAEMGLTRERVRQIQQEAL
VKLKRHFASQGVRKDAVL