Protein Info for ABZR87_RS10830 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13379: NMT1_2" amino acids 34 to 269 (236 residues), 100 bits, see alignment E=5.1e-32 PF09084: NMT1" amino acids 51 to 266 (216 residues), 90 bits, see alignment E=5.4e-29 PF00497: SBP_bac_3" amino acids 61 to 216 (156 residues), 32.6 bits, see alignment E=1.5e-11 PF04069: OpuAC" amino acids 64 to 256 (193 residues), 22.2 bits, see alignment E=2.4e-08 PF12974: Phosphonate-bd" amino acids 68 to 226 (159 residues), 47.6 bits, see alignment E=4e-16

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 98% identity to rpf:Rpic12D_1134)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>ABZR87_RS10830 ABC transporter substrate-binding protein (Ralstonia sp. UNC404CL21Col)
MGTRVIGRWAKWMGAALCATSLLAASPAVLAQGKPEKSKVTIAVGGKALFYYLPLTIAER
LGYFKDEGLDVEIVDFAGGAKALQAVVGGSADVVSGAYEHTLVLQAKGQMYQEFVLQGRA
PQIVLAVNNKTMPNFKSIADLKGKKIGVTAPGSSTNIMVNYVLARAGIKPNEVSIIGVGP
SSGAIAAVRAGQIDALANLDPVMSMLTQKNEVRVVSDTRTLADTKAVFGGNMPAGCLYAS
TAFIQKNPNTTQAMTNAMVRALKWLQKAGPSDIVKTVPEAYLLGDRALYLAAWEKVREAI
SPDGTMPADGPTTALRTLSEFDAEVKGKQIKLDQTFTNTFVQKANAKYK