Protein Info for ABZR87_RS10800 in Ralstonia sp. UNC404CL21Col

Annotation: YbaB/EbfC family nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 104 (102 residues), 97.8 bits, see alignment E=1.8e-32 PF02575: YbaB_DNA_bd" amino acids 10 to 100 (91 residues), 116.8 bits, see alignment E=2e-38

Best Hits

Swiss-Prot: 98% identical to Y1036_RALPJ: Nucleoid-associated protein Rpic_1036 (Rpic_1036) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K09747, hypothetical protein (inferred from 98% identity to rpf:Rpic12D_1128)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>ABZR87_RS10800 YbaB/EbfC family nucleoid-associated protein (Ralstonia sp. UNC404CL21Col)
MMKGQIAGLMKQAQQMQENMKKAQEQLALIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSL
LAEGEDKDLLEDLIAAAFNDAVRKAETTTQEKMGSLTSGLGGMASMLPPGFKLPF