Protein Info for ABZR87_RS10770 in Ralstonia sp. UNC404CL21Col

Annotation: transcription termination factor Rho

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR00767: transcription termination factor Rho" amino acids 2 to 417 (416 residues), 693.5 bits, see alignment E=4.7e-213 PF07498: Rho_N" amino acids 5 to 47 (43 residues), 58.7 bits, see alignment 6.7e-20 PF07497: Rho_RNA_bind" amino acids 52 to 125 (74 residues), 110.9 bits, see alignment E=3e-36 PF00006: ATP-synt_ab" amino acids 160 to 363 (204 residues), 93.7 bits, see alignment E=2e-30

Best Hits

Swiss-Prot: 79% identical to RHO_CHRVO: Transcription termination factor Rho (rho) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K03628, transcription termination factor Rho (inferred from 100% identity to rpi:Rpic_1031)

Predicted SEED Role

"Transcription termination factor Rho" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>ABZR87_RS10770 transcription termination factor Rho (Ralstonia sp. UNC404CL21Col)
MHLTELKSLHVSQLLEMAGQLEIDNAQRMRKQELMFAILKKKAKQGETIFGDGTLEVLPD
GFGFLRSPETSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTPKDGERYFALVKVDKVN
AQPPEAVKNRIMFENLTPLHPNKPLTLERDIKAEENITGRIIDMIAPIGRGQRALLVASP
KSGKTVMLQHIAHAIATNHPEAELFVLLIDERPEEVTEMQRTVRGEVVASTFDEPAVRHV
QVAEMVIEKAKRLVELKKDVVIVLDSITRLARAYNTVVPTSGKVLTGGVDANALQRPKRF
FGAARNLEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGNMEVHLERRLAEKRVYPAINL
NKSGTRREELLIKPDILQKVWILRKFIHDMDEVEAMEFLLDKLKTTKNNAEFFDMMRRGG