Protein Info for ABZR87_RS10735 in Ralstonia sp. UNC404CL21Col

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 201 to 228 (28 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 455 to 475 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_1116)

Predicted SEED Role

"Probable inner membrane transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>ABZR87_RS10735 glycosyltransferase family 39 protein (Ralstonia sp. UNC404CL21Col)
MNTTRVSRIRLTAAATRELPRWLLLAICVIYGLSGLFSRDPWKNEDAAGFGAMWTLATGN
AQDWLMPNIVGRPIVQSGPLVFWIGGAFIRLFGQWLGPADASRLATALFFFVTSACIWYG
AYLLGRRAEVQPFEFVFGGQPNTRDYGRTLADGALLIFLACVGLAQRGHETTPLVGALCF
VAVAVYGLIRALDKPVHGSLIYGIGIGCLSLAGGPILPLAIAVAVLIAAHATRVIPLRPL
LTVALPVSLVLGCSWPAMAYLLANNPTDAVTYIREWARFDRHQYAGPTAHSLGFVARNLP
LFAWPVWPLAAWAWKSWGGMRTAPHITLPLAVFLPQFVLLLMQPHPGDDGFLLLIPPMAV
MATFALPTLKRGAISAIDWFALLAFTILGGTLWLLWIAKMTGFPPQLARNVYRIVPGYRP
EFSWTALVCALLVTAAWVLIVVWRTSRAPKAIWRAVVISAAGTTLMWVLMMTLWLPTINY
AKTYRDVAQSAALALPRTYTCVQPIRMGDAQLASFAYFGHIRFGSAEDNCDILLRHDPYD
YGAPTSVSNYEWRLIWEGRRPADRDEHFRMYRLTEAAAATHPPPTPATTRRRKLRP