Protein Info for ABZR87_RS10410 in Ralstonia sp. UNC404CL21Col

Annotation: lipoprotein-releasing ABC transporter ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR02211: lipoprotein releasing system, ATP-binding protein" amino acids 20 to 239 (220 residues), 315.2 bits, see alignment E=1.1e-98 PF00005: ABC_tran" amino acids 40 to 188 (149 residues), 112.1 bits, see alignment E=1.7e-36

Best Hits

Swiss-Prot: 89% identical to LOLD_RALSO: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to rpi:Rpic_0961)

MetaCyc: 56% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABZR87_RS10410 lipoprotein-releasing ABC transporter ATP-binding protein LolD (Ralstonia sp. UNC404CL21Col)
MSEAVMTSMEAPAAAPQGVVVQAEGLSKSFRQGGLNVDVLKGVDIRIGVGEKVAIVGASG
SGKSTLLHVLGGLDEPTSGRVSLLGKPFTAMKERERNMLRNQALGFVYQFHHLLPEFTAL
DNVAMPLRIRGVEEAQARHTAQAMLERVGLGPRTAHRPGELSGGERQRVAIARALVGSPA
CVLADEPTGNLDDHTAGEVFDLMLELTRTLGTSFVIVTHDIELAGRCDRIFRLRDGHLHQ
ER