Protein Info for ABZR87_RS10405 in Ralstonia sp. UNC404CL21Col

Annotation: lipoprotein-releasing ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 25 to 52 (28 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 317 to 347 (31 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 416 (411 residues), 489.7 bits, see alignment E=3.4e-151 PF12704: MacB_PCD" amino acids 30 to 244 (215 residues), 73.1 bits, see alignment E=4e-24 PF02687: FtsX" amino acids 276 to 409 (134 residues), 62.9 bits, see alignment E=2.8e-21

Best Hits

Swiss-Prot: 50% identical to LOLC_XYLFA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to rpf:Rpic12D_1056)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>ABZR87_RS10405 lipoprotein-releasing ABC transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MKLPYEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIIVLSVMNGFQKEVRD
RMLSVLAHIEVMAPNSLPDWQRTANEAMQNKEVIGAAPYVGAQAMITRDEAVRGVLLRGV
SPADEPKVSDIAKDFKSGTIDDLKPGEFGIALGSQLANGLGVHQGDKVTLVAPQGTITPA
GVLPRLKQFTVTGIFESGHYEFDSSLALVNMEDAERLFRLDGPTGVRLKLVDMDRAPQVA
EALSRTLSGELYIRDWSRQNRNWFAAVKTEKKMMFIILTLIIAVAAFNLVSTLVMTVTDK
QADIAILRTMGAQPASIMKIFIVQGVAIGFIGTLLGVGFGTLIAYNIDVIVPFIERLFHV
QFLPRDIYFISELPSDPRVNDIATIGVISFILASVATLYPSWHASRVNPAEALRYE