Protein Info for ABZR87_RS10355 in Ralstonia sp. UNC404CL21Col

Annotation: 2-hydroxycarboxylate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF03390: 2HCT" amino acids 24 to 434 (411 residues), 523.5 bits, see alignment E=1.7e-161

Best Hits

Swiss-Prot: 55% identical to MAEN_BACSU: Na(+)-malate symporter (maeN) from Bacillus subtilis (strain 168)

KEGG orthology group: K11616, malate:Na+ symporter (inferred from 71% identity to bur:Bcep18194_C6958)

Predicted SEED Role

"Malate Na(+) symporter" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABZR87_RS10355 2-hydroxycarboxylate transporter family protein (Ralstonia sp. UNC404CL21Col)
MEASIRAQENTRAGLWRTLSGYRIGPLPLPVYAAIAVITLLAALNKKLPDDMIGGLAVLM
LLGFLLGEIGARLPVFKHIGGAAILCLFVPSALVGYKVIDPEMLKALTTTMKTANLQYLY
IACLVAGSILGMSHRVLVQGFMRMFVPLLIGTLAAIVAGVTVGLFFGYDPKHTFFFIVIP
IVGGGIGEGILPLSIGYSEILGRPQAELIAMLVPAALLGNVVAILSSGVLKSLGEKRPHL
TGHGDLVKSGNDADLLANDRTDAPLNLGLMGAGLLISCAFFIFGALLSRFTGIPGPILMI
VSAALLKVSKVLPQNMELGAYQMYKFVSTNLTFAILVGLGALFVSWKELMAAFTPGYFAI
CAATVLALVASGFFVGKWLGMYPVESGIVTACHSGLGGTGDVAILSASNRMGLMPFAQIS
TRIGGAAMVVAATILLKVLH