Protein Info for ABZR87_RS10350 in Ralstonia sp. UNC404CL21Col

Annotation: 3-isopropylmalate dehydratase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00171: 3-isopropylmalate dehydratase, small subunit
  • amino acids 1 to 182 (182 residues), 189.7 bits, E=2.4e-60
• PF00694: Aconitase_C
  • amino acids 5 to 122 (118 residues), 109.6 bits, E=7.4e-36

Best Hits

Swiss-Prot: 69% identical to LEUD1_CHRVO: 3-isopropylmalate dehydratase small subunit 1 (leuD1) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 69% identity to cvi:CV_2168)

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• L-leucine biosynthesis (6/6 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• 2,5-xylenol and 3,5-xylenol degradation (1/13 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• C5-Branched dibasic acid metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.33 or 4.2.1.35

Protein Sequence (220 amino acids)

>ABZR87_RS10350 3-isopropylmalate dehydratase small subunit (Ralstonia sp. UNC404CL21Col)
MSDTKRIEGTAAPLPTPNLDTDQIMPKQFLRGIDKSGLDKGLLYDLRYDADHQLRSDCVL
NQPAYQGTSILVGGSNFGCGSSREHAVWGLQQFGIRAVIAPSFGEIFYSNAMNNRLLLVM
LDEATVERILADVSDAATNRIAIDVESMTVRSHSVEASFTLSERHRHMFLHGLDMIGATL
ARWSDIDAFQQAHWKTRPWLRDIAATTRARLAAMAPSGSL