Protein Info for ABZR87_RS10290 in Ralstonia sp. UNC404CL21Col

Annotation: CHASE2 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 777 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details PF05226: CHASE2" amino acids 30 to 311 (282 residues), 197.4 bits, see alignment E=5.3e-62 PF08448: PAS_4" amino acids 434 to 547 (114 residues), 50.6 bits, see alignment E=3.1e-17 PF02518: HATPase_c" amino acids 661 to 770 (110 residues), 88.7 bits, see alignment E=5.4e-29

Best Hits

KEGG orthology group: None (inferred from 93% identity to rpf:Rpic12D_1006)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (777 amino acids)

>ABZR87_RS10290 CHASE2 domain-containing protein (Ralstonia sp. UNC404CL21Col)
MTESAPTKSAVRSLGVRALVEWGVLVALAALLTLGAVRWSVVARLDAALYDAVVTLHGHA
PRDDIVIVAIDDQSLDAVGRWPWPRSRLADLIARVGQARPRAIGVDILLIEPDLAHPEGD
RALIEAIRQAGHVILPALPERTEQGRVYHYPFLGINAAVAHINAAPDADSVVRGMYLAEG
PSAHLLDHLAVQLARQALRSPASVPALPDVETDAGGWTRRGHIRLNFAGQAGTYRHVPAL
DVLNGHVAPDALAGKLVLIGATASGVSDIFATPPSRTMSGVEVLANATQTVLDSSAILPV
SPSVFWAMTLLPLLMTAFAVRWLTPRMALAVALAGAAVLLLSAIGALVFGNRWLPPFAAL
VGPLVLYPLWSWRQQEAALRFLRDEMQRLAREPGLLAETAPLARPGRTLGAHMDAVASLT
DKLRGLRRFLADALESLPDATVVCTHDGTIRLANGRSADLAGQSQTPGQNRAAALRDLPT
LLARAFPDPSAGEHYWARWLTDPTGLEPVELQTHDGRSMLMHAAALRDEAGRPVDIIVSF
ADITPVRQAERHREEALRFISHDMRSPQSAILALIELQRDASRALDREVLLSRIEQLSSR
TLELADAFIDLARAESQTLKLVDVDLVGLVLDAADEVWPLANRHQVEVRVMADIEAAVRG
EPRLLVRALVNLLNNAIKFSAAGSVVTVTVEQDEAMFSVAVADQGAGIALADQPRLFQPF
HRLHEGAANAPAGSGLGLVFVKTVVDRHGGRIAVQSAPGLGSTFTLWLPRVAHRHDA