Protein Info for ABZR87_RS10175 in Ralstonia sp. UNC404CL21Col

Annotation: MucB/RseB C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF03888: MucB_RseB" amino acids 48 to 223 (176 residues), 181.9 bits, see alignment E=8.6e-58 PF17188: MucB_RseB_C" amino acids 244 to 347 (104 residues), 89.9 bits, see alignment E=1e-29

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 98% identity to rpi:Rpic_0922)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>ABZR87_RS10175 MucB/RseB C-terminal domain-containing protein (Ralstonia sp. UNC404CL21Col)
MSKVWHPVAGAGARKLQAVRRSVFLLLCVSALATAAQPQPDPMPRKEAASWLAKIHRAAL
KQNYVGTLTYQRGTGMHSTRIQHYADLFNNEYERVEALDGKQREMLRQNDLVRNLIYDVK
LVVTEKQEHKDSFPALLATTNGDVLDQYDMRHLPSERVAGMDCEVFQLDPKDGYRYAYRI
WAERNSGLLMRAQTIGEDGKVLEQVAFSQVELGVPSEKQKIVAAFKNLNGWNQYEIVTQP
TNLAEQGWTIGNPIKGFQKIREVRRPLGDIAPAGKNSSGFEVQQVVFSDGLAGLSLFIEP
VSEKRTRREGFISQGATHVMVRRVADFWLTVVGEVPFATIKQFGAAVDYKPASANATNKP
ASAPQ