Protein Info for ABZR87_RS10135 in Ralstonia sp. UNC404CL21Col

Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 5 to 326 (322 residues), 421.3 bits, see alignment E=1.2e-130 PF00108: Thiolase_N" amino acids 53 to 152 (100 residues), 33.1 bits, see alignment E=6e-12 PF08545: ACP_syn_III" amino acids 114 to 191 (78 residues), 119.5 bits, see alignment E=6.6e-39 PF08541: ACP_syn_III_C" amino acids 237 to 326 (90 residues), 121.6 bits, see alignment E=1.8e-39

Best Hits

Swiss-Prot: 99% identical to FABH_RALPJ: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 99% identity to rpf:Rpic12D_0980)

MetaCyc: 39% identical to 3-oxoacyl-(acyl-carrier-protein) synthase III (Agrobacterium fabrum C58)
RXN-22027

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>ABZR87_RS10135 beta-ketoacyl-ACP synthase III (Ralstonia sp. UNC404CL21Col)
MTRFARIIGTGSYLPPKRVTNDELAAQLAEKGIETSDDWIVSRSGIRARHFAEPDVTCSD
LAVKAAERAIEAAGIDRSELDLILVATSTPDFVFPSTACLVQQKLGITNGCAAFDVQAVC
SGFVYALATADKFIRSGAYRNVLVIGSEVFSRIIDFSDRTTCVLFGDGAGAVVLQASDEP
GILSTALHADGSHANILCVPGNVAAGAIQGSAFLYMDGQAVFKLAVTVLDKVAREALAAA
ELDASQVDWLIPHQANIRIMQGTTKKLGLSNERLIVTVDEHGNTSAASIPLALDVAVRDG
RIQRGQHVMLEGVGGGFTWGAALLRF