Protein Info for ABZR87_RS10120 in Ralstonia sp. UNC404CL21Col

Annotation: YceD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF02620: YceD" amino acids 70 to 175 (106 residues), 80.3 bits, see alignment E=6e-27

Best Hits

KEGG orthology group: K07040, uncharacterized protein (inferred from 94% identity to rpf:Rpic12D_0977)

Predicted SEED Role

"COG1399 protein, clustered with ribosomal protein L32p"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>ABZR87_RS10120 YceD family protein (Ralstonia sp. UNC404CL21Col)
MDFRTFDLFAFIRAGEPASGAVLLTDMPRLLAEQAADAPADADTQFHWRLQGLVREEASV
GQLPRQRLFVDLEVDGAVWLQCQRCLKAYEQPLPVRTRLEVMRSEAEADAAPLDDDEADV
IVGSRHFDLITQIEDELLLALPVSPRHAVCPDEVLPEEAEAEKKPSPFAVLANLKTKH