Protein Info for ABZR87_RS10090 in Ralstonia sp. UNC404CL21Col

Annotation: RluA family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00005: pseudouridine synthase, RluA family" amino acids 37 to 333 (297 residues), 273 bits, see alignment E=1.6e-85 PF01479: S4" amino acids 41 to 87 (47 residues), 32.2 bits, see alignment 7.3e-12 PF00849: PseudoU_synth_2" amino acids 117 to 266 (150 residues), 112 bits, see alignment E=3.1e-36

Best Hits

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 97% identity to rpi:Rpic_0906)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>ABZR87_RS10090 RluA family pseudouridine synthase (Ralstonia sp. UNC404CL21Col)
MNELRHPFDGRIQQAGRGTLADALDGKSVAYVEIGEDAEGQRIDNFLMRVAKGVPKSHIY
RIVRSGEVRVNKGRIDAEYRLKLGDLVRIPPLRIAQQAEAPRAVPAAEFTILHEDTHLLV
IDKPAGVAVHGGSGVAFGVIEQLRQSRPEAKFLELVHRLDRETSGVLLLAKKRSALVALH
EQIREGQLDKRYFAAVKGVWPHKRQHIKSPLHKYTTPEGERRVRVQADGQASHTIFNKVG
VFGPYTLLEAELKTGRTHQIRVHLAHAGCPILGDDKYGDFALNKALSRANASPRLARMFL
HAHRLQLTHPQSGEIVTFTAPLPAECADFLNAFQGPDSDAAAAL