Protein Info for ABZR87_RS10040 in Ralstonia sp. UNC404CL21Col

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 2 to 387 (386 residues), 474.6 bits, E=1.4e-146
• PF17767: NAPRTase_N
  • amino acids 7 to 128 (122 residues), 124.8 bits, E=2.7e-40
• PF04095: NAPRTase
  • amino acids 163 to 388 (226 residues), 265.2 bits, E=6e-83

Best Hits

Swiss-Prot: 98% identical to PNCB_RALPJ: Nicotinate phosphoribosyltransferase (pncB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 98% identity to rpi:Rpic_0896)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Protein Sequence (389 amino acids)

>ABZR87_RS10040 nicotinate phosphoribosyltransferase (Ralstonia sp. UNC404CL21Col)
MIIRSLLDTDLYKFTMMQVVLHHFPGANVEYRFKCRNAGVDLVPFIEEIRAEIRHLCTLR
FTDPELDYLRGMRFIKSDFVDFLGLFHLNEKYIDVRPAPSNDGQIEIVIAGPWLHTIMFE
VPVLAIVNEVFFSRTQTHPQWEEGKRRLTDKLASLKRPGLEDCRIADYGTRRRFSHTWHE
HVLLETRAQLGAQYAGTSNVHFAMKHGMTPLGTMAHEYLQACQALGPRLRDSQIFALETW
AKEYRGDLGIALSDTYGFDAFLRDFDMFFCKLFDGVRHDSGDPFEWGERMLKHYDDMRAE
PKSKALIFSDSLDMPKVIGLYERFHGRCKLAFGVGTNLTNDLGYTPLQIVIKMVRCNGQP
VAKLSDAPEKTMCDDPAYLTYLKQVFGVQ