Protein Info for ABZR87_RS10000 in Ralstonia sp. UNC404CL21Col

Annotation: Fe-S protein assembly co-chaperone HscB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00226: DnaJ
  • amino acids 11 to 78 (68 residues), 28.8 bits, E=1.1e-10
• TIGR00714: Fe-S protein assembly co-chaperone HscB
  • amino acids 21 to 176 (156 residues), 105.3 bits, E=1.7e-34
• PF07743: HSCB_C
  • amino acids 95 to 169 (75 residues), 67.4 bits, E=1.2e-22

Best Hits

Swiss-Prot: 87% identical to HSCB_RALSO: Co-chaperone protein HscB homolog (hscB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 97% identity to rpi:Rpic_0888)

MetaCyc: 39% identical to [Fe-S] cluster biosynthesis co-chaperone HscB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Protein Sequence (179 amino acids)

>ABZR87_RS10000 Fe-S protein assembly co-chaperone HscB (Ralstonia sp. UNC404CL21Col)
MNSGLSANTTHFSLFGLPEHFEVDDDALNAAYRTVQSQAHPDRYAHAGDAERRVAMQWAT
RANEAYQTLRDPLKRATYLLHLRGIDVQAENNTAMPPAFLMQQMEWRETLGDAKAERNVD
ALDDLLTMLRKEKRTRYQALSGLLGGDGNTAAAADAVRQLMFIEKIERDTAEAIDRLDD