Protein Info for ABZR87_RS09945 in Ralstonia sp. UNC404CL21Col

Annotation: recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 363 to 385 (23 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details amino acids 499 to 525 (27 residues), see Phobius details amino acids 566 to 588 (23 residues), see Phobius details amino acids 597 to 615 (19 residues), see Phobius details amino acids 621 to 644 (24 residues), see Phobius details PF10136: SpecificRecomb" amino acids 37 to 679 (643 residues), 765.8 bits, see alignment E=1.8e-234

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_0877)

Predicted SEED Role

"Site-specific recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>ABZR87_RS09945 recombinase (Ralstonia sp. UNC404CL21Col)
MFNFLLNPWRKWRASRHASHQLDAILAQFEPTRSLAERNEWLIELAYWLRRADRPAGAAS
ESWRYARLRYLLQVLENNPALAERVGRTLRSIVQDNDPVSLLCDTGLSSRSGFWSELLDR
WQARLLPPAPNQPQLATLFALMFVGPTDAQWVDGLDDELVTRLYALFRAGMTEDEHAAGQ
TRLERSLGIGIQILISQVRAAGLSRGIRSRMDHAELTDSPFYLLADAANAIFLERPNAEL
ASPERFLQELNYFRAVLDRCRTATASVYQHLDENGVSVEVVFQVERMKAWLGRIDLLLTA
WADTQGSRRFVHMTAELVSASQHRRSVGYLIRSTFADLARKVVERSAESGEHYITRDGKE
YGAMVKAAAGGGVITAATVYIKFFITGAHLSRFTEGLFASINYAVSFLGIHFAHFTLATK
QPAMTAPALAHRLDQVGRQEGLDRFVDDTVAMIRSNAAAIAGNLVAVAPVAFLVQWLAGR
FFHTDLISAAKAMATIDSFSILGPTPLYAIFTGVLLWASSLAAGWADNWFALHRVHDVIA
YHRRLRFMVGTQGAQRIASFWKRNLSGIVANVSLGFMLGLGPEILSFFGPHMEVRHVTLS
TGAVATAVGVLGPSVMHTAPFWLAVAGIALMGVLNVLVSFALAFNMAMRSRNLRGVDRKR
VTGAVWRRILRDPLCLLVPRAPTVSTPPSTSTPV