Protein Info for ABZR87_RS09910 in Ralstonia sp. UNC404CL21Col

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF00881: Nitroreductase" amino acids 23 to 173 (151 residues), 56.4 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 99% identical to Y870_RALPJ: Putative NADH dehydrogenase/NAD(P)H nitroreductase Rpic_0870 (Rpic_0870) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 99% identity to rpf:Rpic12D_0935)

MetaCyc: 53% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.298

Use Curated BLAST to search for 1.-.-.- or 1.1.1.298

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>ABZR87_RS09910 malonic semialdehyde reductase (Ralstonia sp. UNC404CL21Col)
MPMLEPSALDQLFHAARTHNVWLDKPVDDELLHTLYDTVKYGPTAANSTPARFVFVKSAA
AKERLIPCMSAGNQEKTRQAPVAVIVAYDTQFHEQLPKLFPHTDARSWYAGDQAKINAAA
LMNGSLQGGYLVLAARALGLDCGPMAGFDADKVNETFFPDGQWKVNFIMNIGYGDAEKLH
PRNPRLSFEEACKII