Protein Info for ABZR87_RS09860 in Ralstonia sp. UNC404CL21Col

Annotation: spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_0860)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• spermidine biosynthesis I (2/2 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle III (3/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Protein Sequence (291 amino acids)

>ABZR87_RS09860 spermidine synthase (Ralstonia sp. UNC404CL21Col)
MTLLKRKSIEAVASRRPARAKREDRQSHDDEPKRMAPRFAPVTFSELAGVRYLHFGTEWV
QGAMRLSKPDAIELEYAQQMMAWLLFLDPAARADFRVVQLGLGAAALTKFCHRHLAPAQV
TAVELNPSVIVAARSMFGLPFDDARLSVLEQDAYDWVMDASHHGTVDALQIDLYDATARG
PVLDTPAFYKACRQVLRSPGVMTINLFGDHTSFPRNIERICDAFDNRVLVFPEVHDGNVI
ALAFNGPPLHVSWEDVQARAAALQASLKLPTKGWADGLRSANAGQEDALSI