Protein Info for ABZR87_RS09780 in Ralstonia sp. UNC404CL21Col

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 372 to 396 (25 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 438 to 460 (23 residues), see Phobius details amino acids 526 to 549 (24 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 4 to 548 (545 residues), 509.3 bits, see alignment E=6.8e-157 PF02652: Lactate_perm" amino acids 15 to 546 (532 residues), 514 bits, see alignment E=2.5e-158

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 99% identity to rpf:Rpic12D_0908)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>ABZR87_RS09780 L-lactate permease (Ralstonia sp. UNC404CL21Col)
MWNQVYDPLGSAVWSTIAAGIPVAVLLCSLAFFHMQAHLAAGLALIVGVGIASFVFGMPT
TMAGKAAGLGIVSGLFPIGWIVLNIIFLHRLTTLNGSFKVLQSSISGITEDRRLQLLLVA
FSFGAFFEGAAGFGTPVAVTGAILIGLGFSPLAASGLALIANTAPVAYGALGAPLIGLAS
VTGLDLLQLSAMVGRQLPFFSVLVPFWLIWAFAGFRGMLQIWPAILVAGVSFAIPQFLVS
NFHGPWLVDVIAALVSMGTLTLFLKVWKPKTIWTSTALRNREDNSRVDPEAAAEAREATT
GTNGKITRVQAWLPWVILTVFVFIWGVPQFKAFADGLWAFKFAIPGLDKMVLKGPPVVPK
VIAEGAVFNFNVLSMAGTGILVSAIVGGLLMGYSLPRMAKEYWNTIKLTRYSLLTICAMF
GIGYLTRYSGLDATLGLAFAHTGVLYPLFGTMLGWLGVALTGSDTASNVLFGGLQKTTAE
QLGLSPILMSAANSSGGVMGKMIDAQSIVVASTATKWYGHEGDILRYVFFHSLALAFLVG
LMITLQAYVEPFTRMVVH