Protein Info for ABZR87_RS09770 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 342 to 367 (26 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 34 to 222 (189 residues), 54.9 bits, see alignment E=7.6e-19 amino acids 242 to 438 (197 residues), 60.7 bits, see alignment E=1.3e-20 PF07690: MFS_1" amino acids 67 to 391 (325 residues), 97.5 bits, see alignment E=8e-32 amino acids 265 to 426 (162 residues), 44.6 bits, see alignment E=9.4e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0906)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABZR87_RS09770 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSNHTSAPSYAGRAGTQATGHAQPLSRTRAIAAITIGNGLEFYDFVVYSFFATLIGRLYF
PVGNATGQLLMSFATFGVGFLMRPLGGLLIGMYADRAGRKPAVALTLWLMGLSSLVFVVT
PTYAQIGILAPMLVVLARLVQGFAIGGEMGASTALLLEYADDRSRGFYTSWQPFSQGLAA
LFGALVGLLLSNVLAPAALESWGWRLAFVIGILVIPVGLIIRRRLEETAAPPSTREADAT
LPLLREHRRALVASILLMIGVASSTYIIVYYLSNYAVSVLHMPLSLGIWAACIAALVQVV
LSPFAGRLADRVGRRKVVLWSRVALLAMIYPAFALINADPSLARLLIVVGCLSVPMSMTS
PASMVLVSEVLPQRLRATGLSIAYCVAIAIFGGFAQFFSTELIHLTGNANAPAFYVIGCG
LVSLIGLAMVPETLGRRLS