Protein Info for ABZR87_RS09765 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF00324: AA_permease" amino acids 12 to 447 (436 residues), 374.1 bits, see alignment E=1e-115 PF13520: AA_permease_2" amino acids 15 to 418 (404 residues), 132.1 bits, see alignment E=2.8e-42

Best Hits

Swiss-Prot: 60% identical to PROY_SALTY: Proline-specific permease ProY (proY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 99% identity to rpf:Rpic12D_0905)

MetaCyc: 44% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Histidine transport protein (permease)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>ABZR87_RS09765 amino acid permease (Ralstonia sp. UNC404CL21Col)
MEHLQRNLRARHIRFLALGSAIGTGLFYGSASAIQLAGPAVILAYIIGGAAVYMVMRALG
EMAVRQPVSGSFGRYARDNLGPLAGFLTGWTYILEMVIVCLADVTAFGIYMGFWFPEVPQ
WIWVLGIVMLICGLNLCNVKVFGEMEFWLALIKIVAIGAMIVGGTVILFLGVKMNGEHAS
GLSNLWSHGGFLPHGVGGLLASFAVVMFAYGGVEIIGITGGEAQNPDKVIPKAINAVPAR
ILLFYVLTMCVLMAIFPWTGIDGQGSPFVQIFSGLGIQSAAAILNLIVISAAISAINSNI
FGAGRMMYGMAEQGQAPRIFAATSRHGVPWVTVLFMAGALLCGVVLNYLIPENVFVIIAS
IATFATVWVWLMILLSQVAMRRRLSAEEVRALKFKVPLWPVGPALAIAFMLFVIGVLGTM
EDTRVALYVGAGWVLLMSAAWYLRVKPNAAAVLAEEASGA