Protein Info for ABZR87_RS09740 in Ralstonia sp. UNC404CL21Col

Annotation: DNA topoisomerase IV subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 PF02518: HATPase_c" amino acids 35 to 176 (142 residues), 42.7 bits, see alignment E=1.4e-14 PF00204: DNA_gyraseB" amino acids 267 to 403 (137 residues), 116.7 bits, see alignment E=1.7e-37 PF01751: Toprim" amino acids 431 to 541 (111 residues), 45.9 bits, see alignment E=1e-15 PF00986: DNA_gyraseB_C" amino acids 587 to 651 (65 residues), 80.9 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 99% identity to rpf:Rpic12D_0900)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (661 amino acids)

>ABZR87_RS09740 DNA topoisomerase IV subunit B (Ralstonia sp. UNC404CL21Col)
MSKTSQYSESSIKVLKGLEPVKQRPGMYTRTDNPLHIMQEVIDNSADEALGGYGKLIAVT
LHKDGSMSVEDDARGIPVGIHPEEGVPVVEIVYTRLHAGGKFDKGRGGAYAFSGGLHGVG
VSVTNALSTRLEVTVWRDGNVSTLAFSGGDVIEPLTTRKAERGEKKSGTRVRAWPDPKYF
DSENIPQAELQRLLRSKAVLLPGVKVTLTLEKTGETLEWQYDQGLRGYLIESLAQGSGAE
PVIPLFEGEHFADPDKPGEEGFAFGEGASWVVAWTEEGSPVRESYVNLIPTPAGGTHESG
LREGLFQAVKSFVEMHALLPKGVKLMSEDVFARASFVLSAKVLDPQFQGQIKERLNSRDA
VRLVSTFSRPALELWLNQHVDHGKKLAELVIKQAQARTRAAQKVEKKKGSGVAVLPGKLT
DCESDDVTRNELFLVEGDSAGGSAKMGRDKEFQAILPLRGKVLNTWETERDRLFANNEVH
DIAVAIGVDPHGPNDTVDLSGLRYGKICILSDADVDGAHIQVLLLTLFFKHFPQLIDRGH
VCVARPPLYRVDAPARGKKPAQKLYALDDGELEAIEDKLRKDGVKEGAWQISRFKGLGEM
SAEQLWETTMNPDTRRLLPVALGELGQDQTINMMNMLMGKGEAGARRTWLEARGNEVEAD
I