Protein Info for ABZR87_RS09680 in Ralstonia sp. UNC404CL21Col

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 16 to 189 (174 residues), 221.5 bits, see alignment E=3.3e-70 PF03741: TerC" amino acids 18 to 188 (171 residues), 161.7 bits, see alignment E=7.5e-52

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_0891)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABZR87_RS09680 TerC family protein (Ralstonia sp. UNC404CL21Col)
MEWLSDIFTMQFAAALASIIVIDLVLAGDNAILIALAARNLPPELQKKAIMWGAAGAIVV
RALMTLAVVWLLKIPGLMLVGGLALVWIAWKLLADDGQGGDEHGAGSTTLMGAMKTIIIA
DAVMGIDNVLAIAGASHGSFLLVVLGLLISVPVVVWGSGVVLRLIERFPIIIYGGAAVLA
YTAAHMIVAEPVLKAFFAAQPPLKWAVYVVVFLIVLGGGWLVQRRRQQPA