Protein Info for ABZR87_RS09635 in Ralstonia sp. UNC404CL21Col

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00157: ribosome small subunit-dependent GTPase A
  • amino acids 52 to 306 (255 residues), 212.5 bits, E=3.6e-67
• PF03193: RsgA_GTPase
  • amino acids 72 to 248 (177 residues), 175.4 bits, E=4.8e-56

Best Hits

Swiss-Prot: 98% identical to RSGA_RALPJ: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 98% identity to rpi:Rpic_0811)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (315 amino acids)

>ABZR87_RS09635 ribosome small subunit-dependent GTPase A (Ralstonia sp. UNC404CL21Col)
MTRGKPGRAHKRAATGEHGLVIAAHGRHYLVEREGGGFLQCFPRGKRSECAVGDRVVYEA
TAVDQGVVVRVDERRNLLYRSDQFKSKVLAANLDQVIIMLGTEPSFSEDLLGRALVAAES
LGITPLILLNKIDLTARLETARSRLALYRDLGYTIVELTVHGAPAAAHAALEPHVAGRAS
ILIGQSGMGKSSLLNLLIPGVDAQTREISEKLDSGKHTTTFTRLYHLPAEWGQGGVLIDS
PGFQEFGLHHLSEGMLERAFPEFRPRLTECRFYNCRHLQEPGCGILGAMAEGKIDPRRHQ
LYAQLLHESEQQKPW