Protein Info for ABZR87_RS09565 in Ralstonia sp. UNC404CL21Col

Annotation: Lrp/AsnC ligand binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 58 to 80 (23 residues), see Phobius details PF13412: HTH_24" amino acids 11 to 57 (47 residues), 68.7 bits, see alignment E=3.7e-23 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 62.8 bits, see alignment E=3.1e-21 PF01037: AsnC_trans_reg" amino acids 75 to 156 (82 residues), 84.5 bits, see alignment E=5.8e-28

Best Hits

Swiss-Prot: 58% identical to LRP_ECOL6: Leucine-responsive regulatory protein (lrp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 98% identity to rsc:RCFBP_20554)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>ABZR87_RS09565 Lrp/AsnC ligand binding domain-containing protein (Ralstonia sp. UNC404CL21Col)
MRTQRKPVRALDKLDRRILDLLQKDGRLSMKELSEAVGLTITPCIERVKRLEREGFILGY
YARLNPAMLGASLLVFVEISLGSKSGNMFEQFRREVLRIPEVLECHLVSGDFDYLIKARI
REMSEYRRLLGDILLQLPGAVQSKSYIVMEEIKETLAIDVTEEGA