Protein Info for ABZR87_RS09520 in Ralstonia sp. UNC404CL21Col

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 61 to 366 (306 residues), 279.6 bits, E=1.5e-87
• TIGR02282: lytic murein transglycosylase B
  • amino acids 63 to 368 (306 residues), 392.6 bits, E=4.9e-122

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 97% identity to rpf:Rpic12D_0859)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (374 amino acids)

>ABZR87_RS09520 lytic murein transglycosylase B (Ralstonia sp. UNC404CL21Col)
MSQSPSSRRPVLRALVAGAALSALSFPALSLAAKKAAKSPKRRVAVHEEEIDPDRYRNNP
QTQAFIGMLVAQYNFDRTSLDTLFAGTAYSATVARLILPPATPSRRSWTAYRGRFIEPIR
IGAGVRFWQQYGDTLRRAENEFGVPADVIVGILGVETIYGRDMGNFRVIDALSTLAFDYP
DTPNREDRSTMFRNQLKDFLLWCRDTGTDTFSVLGSYAGAVGIPQFMPTSIREYAIDYDR
DGHIDLRNSAIDAIGSVARFLQMHGWEPNRPVMWNIAGDPDSQGIAAAAADGQPYPGMTL
SKLTRAGLKLTPGVDAAREQETEVLMIDLPTPGQPTEYRVGLRNFYVLTRYNRSFFYAAA
VYELGQAVRQAMQG