Protein Info for ABZR87_RS09495 in Ralstonia sp. UNC404CL21Col

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 431 (431 residues), 440.2 bits, E=3.3e-136
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 179 (179 residues), 213.7 bits, E=3.5e-67
• PF02558: ApbA
  • amino acids 3 to 105 (103 residues), 23.2 bits, E=9.6e-09
• PF00984: UDPG_MGDP_dh
  • amino acids 209 to 301 (93 residues), 124.6 bits, E=2.9e-40
• PF03720: UDPG_MGDP_dh_C
  • amino acids 325 to 434 (110 residues), 111.9 bits, E=3.7e-36

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 99% identity to rpf:Rpic12D_0854)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (454 amino acids)

>ABZR87_RS09495 UDP-glucose/GDP-mannose dehydrogenase family protein (Ralstonia sp. UNC404CL21Col)
MKITIIGSGYVGLVTGACLAELGNDVFCLDVDQKKIDLLNAGGVPIYEPGLKELIERNRA
AGRIQFSTDVAASVAHGDVQFIAVGTPPDEDGSADLKYVLAAARNIAQHMTGFKVIVDKS
TVPVGTGDKVRAAVGEVLATRGKSDIGFSVVSNPEFLKEGAAVDDFMRPDRIVLGTYGDA
DGLRAKAIMRTLYAPFNRNHERTFYMDVRSAEFTKYAANSMLATRISFMNEMANLADKVG
ADIELVRLGIGSDPRIGYSFLYAGTGYGGSCFPKDVQALVRTAQEYGQTLHVLEAVEAVN
DKQKEVLVEKIEDRLGADLTGRTFAIWGLAFKPNTDDMREAPSRILIAALLARGARVQVY
DPVAMEEARHALALDLSAEQLERVTFCAGQMDALKNADALVIVTEWKAFRSPDFNAVKAL
LKTPMVFDGRNLFEPQAMRDAGFEYQAIGRSTQS