Protein Info for ABZR87_RS09460 in Ralstonia sp. UNC404CL21Col

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03807: F420_oxidored" amino acids 10 to 90 (81 residues), 30.9 bits, see alignment E=6.7e-11 PF03446: NAD_binding_2" amino acids 12 to 146 (135 residues), 25.7 bits, see alignment E=2.2e-09 PF02153: PDH_N" amino acids 22 to 173 (152 residues), 124.6 bits, see alignment E=5.3e-40 PF20463: PDH_C" amino acids 181 to 278 (98 residues), 95 bits, see alignment E=6e-31

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 95% identity to rpi:Rpic_0776)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>ABZR87_RS09460 prephenate dehydrogenase (Ralstonia sp. UNC404CL21Col)
MASSFSSSRLVIVGVGLIGGSLALALRRAGVVQHVVGVGRSAASLEAAIRLGVIDEALPM
EEAVRGADMVVLCAPVAQTLPLLLAMQPHLGPDTVVTDAGSTKSDVIMAAKTALGDQVSQ
FVPAHPIAGRELNGVEAALADLYVGKKTVLCPLQENRRSDIARVQAMWEAAGAYCHIMSA
VQHDAVFAAVSHLPHVLSYALVAQIINAEDASLKLDFAGGGFRDFTRIAASSPEMWRDIC
LSNRDALLRELTTYEAVIGRLKTMIAEHDGASLERVFRRASEARLAWPQRVAAANATGPQ
SE