Protein Info for ABZR87_RS09415 in Ralstonia sp. UNC404CL21Col

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00702: Hydrolase" amino acids 12 to 187 (176 residues), 95.2 bits, see alignment E=1.4e-30 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 13 to 223 (211 residues), 172.2 bits, see alignment E=2.3e-54 PF13419: HAD_2" amino acids 13 to 192 (180 residues), 106.7 bits, see alignment E=3.3e-34 PF12710: HAD" amino acids 13 to 183 (171 residues), 32.9 bits, see alignment E=1.8e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 93 to 187 (95 residues), 40.7 bits, see alignment E=6.1e-14 PF13242: Hydrolase_like" amino acids 149 to 197 (49 residues), 39.5 bits, see alignment 8.6e-14

Best Hits

Swiss-Prot: 41% identical to MUPP_PSEAE: N-acetylmuramic acid 6-phosphate phosphatase (mupP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 97% identity to rpf:Rpic12D_0838)

MetaCyc: 42% identical to N-acetyl-beta-muramate 6-phosphate phosphatase (Pseudomonas putida KT2440)
RXN-18659 [EC: 3.1.3.105]

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.105 or 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>ABZR87_RS09415 HAD-IA family hydrolase (Ralstonia sp. UNC404CL21Col)
MTMSRFPDPLGAVLFDLDGTLADTAPDLAAAANKVRTDRGLEPVEYEALRPVASHGARGL
IGVAFGVGPGDAEFESLRLAFLANYEAEICVRTQLFPGMAEVLVELGRAGIPWGIVTNKS
GRLTVPLVAQLPFPVPPACVVAGDTTPHAKPHPAPLLHAAESIGVDARQIVYVGDDLRDI
EAGRAAGMPTIAASYGYCGNGPSPVEWRADALIASAAELIPLLLESQRA