Protein Info for ABZR87_RS09375 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 818 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 290 to 310 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 53 to 271 (219 residues), 89.7 bits, see alignment E=5.1e-29 PF00512: HisKA" amino acids 323 to 386 (64 residues), 55.4 bits, see alignment 1.3e-18 PF02518: HATPase_c" amino acids 435 to 550 (116 residues), 97.9 bits, see alignment E=1.3e-31 PF00072: Response_reg" amino acids 592 to 706 (115 residues), 80.6 bits, see alignment E=2.4e-26 PF01627: Hpt" amino acids 731 to 807 (77 residues), 32.2 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpi:Rpic_0759)

Predicted SEED Role

"FIG00974928: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (818 amino acids)

>ABZR87_RS09375 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MATGDAVNNVAAMVRALILPLWLGLMSASGHAAAPSLYTPEEHAWIAAHPVVRTCVDAHW
RPFEFVKGGKVAGMVPSFLDAVAQLSGLRFEYVDGACWNGSLAALKRGQVDMLPDWSKDE
AEAPYREGFIASTPYYVGTIAIVTAEQENLFASFSQLSGKRLAIKGGGGLELAIRRSSVP
VKLLTFQNESDALEAVVDGDADAALGTDASIVPQLHRQFKGRLFLSGSLWDRPYALTMVT
RDDNPVLASILDKSLTAISASDADAIRQRWQETTDYGAPSLASILHYRWQQVALVAAIVL
AFAVLAYVLWRARVAAVRSERDKAMFLAFISHEIRTPMHTILASLELLQRSQLTGQQASR
ADAAVSASETLLALLDDVLEYSRLESRSVTLALRPTMIGPWAEQTLGMVRWRAEDQALAL
SLDLACAPDFSVDIDAMRVRQIALNLLVNAIKFTSAGKVVFRVDYLPRKRRGTGTLVLEV
RDTGMGIPPERQRNIFEPYARVESPGNRGASGSGLGLSICRELVELMEGVITVSSSPEVG
TVFTVMLPTREAHTEAALPKAGEESSGAVPQGISPPQPQKPQSPESKQGPLVLVVDDHEA
VQHAIQHQLDALACRSAIAGTGEAALEQFASAAFDMVLLDCNLPGIDGYTVAQRMREIEH
QRGGERTPIVAISAATDDAHRVRCFDSGMDGVLGKPLRLAALRELIELWCAHGDSGSNAE
SIEHDMAPAVDVLAIYRQTMKTDLEMLAQGLANRNIEQARRAAHRISGAAAVVDDLHTRG
LASELERRLSQSFGDITADMQALLAEIQSLHGADTPNA