Protein Info for ABZR87_RS09330 in Ralstonia sp. UNC404CL21Col

Annotation: YbfB/YjiJ family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF06779: MFS_4" amino acids 32 to 393 (362 residues), 395.3 bits, see alignment E=3.3e-122 PF07690: MFS_1" amino acids 32 to 335 (304 residues), 34.4 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 93% identity to rpi:Rpic_0751)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>ABZR87_RS09330 YbfB/YjiJ family MFS transporter (Ralstonia sp. UNC404CL21Col)
MEHTLLSSSALSAAHSKRVTAWRVAIAGMVALSVAMGIGRFAFTPILPMMLHDGSVTLAQ
GSWLAAGNYLGYFVGALACMAVRGDAARLIRTGLIATVLLTAGMGMLQGQPVWFVLRFAA
GMASALVFVFTAGWCLHRLTELGHAALGGIIFCGPGLGIAIPGLAASGMVALGWHAMSAW
MAFGVLSALLSAAVWSTIRPEAHAHAAPAPAASGTTPGLDAPTSALTIAYGLAGFGYIIT
ATFLPVIARKVLPAGSVWPDLFWPMFGAGVALGAFLSTRISLARDNRSLLASAYAMQAVA
VGISIVWPTVAGLALSSTLLGLPFTAITLFAMREARRLWPHAAPRLMGLMTAAYGIGQIA
GPPLANRLFAATGGFNASLAVAAVSLVAGVVIFVAVRRASPARA