Protein Info for ABZR87_RS09320 in Ralstonia sp. UNC404CL21Col

Annotation: nodulation protein NfeD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 255 to 277 (23 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF01957: NfeD" amino acids 368 to 456 (89 residues), 57.2 bits, see alignment E=9.4e-20

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 86% identity to rpi:Rpic_0749)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>ABZR87_RS09320 nodulation protein NfeD (Ralstonia sp. UNC404CL21Col)
MRPSLRMRHWMGWLAAAVAAVWTTLAVAAAPVVVLPVTGAIGPASAAYVIRGLQQAREQG
AQLVVLQMDTPGGLDASMRQIIQAILASPVPVAGYVAPGGARAASAGTYILYACHVAAMA
PATNLGAASPVAIGMGGHAPGPGEGAKPASAPASPSSNEDTLARKQMHDAAAYIRGLAQL
RGRNAEWAERAVREAVSLDAPEAASQHVIDLVAASLSDLRRQVDGRALRTSAGTVTLHTA
DAPTVTLEPDWRNRFLGIITDPSLALLLLTVGVYALIFEFSTPGMVVPGILGAVCIVVAL
YGLQMLPISYAGLALIALGLCCMVAEAFLPTFGALGVGGIVAFVLGAVMLIDTQTPGFGV
PLPLILSMALVSLVVILLLSSMAVRARRRPHVSGGDTIIGMTGELLELDSTDAGDPAAGW
AQVRGERWRVHCDGPMARGDRVRVTARHGLTLRVVPASS