Protein Info for ABZR87_RS09315 in Ralstonia sp. UNC404CL21Col
Annotation: slipin family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to Y1420_ARCFU: Uncharacterized protein AF_1420 (AF_1420) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_0748)Predicted SEED Role
"Putative stomatin/prohibitin-family membrane protease subunit aq_911" in subsystem YbbK
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>ABZR87_RS09315 slipin family protein (Ralstonia sp. UNC404CL21Col) MIYGFFSAGGLIFVAVLLVISSFRVLREYERGVVFMLGRFWRVKGPGLVLLIPAVQQMVR VDLRTVVMDVPPQDVISRDNVSVKVNAVVYFRVVDPERAIIHVANFLEATSQLAQTTLRA ILGKHELDEMLAEREKLNLDIQKVLDIQTDPWGIKIANVEIKHVDLNESMIRAIARQAEA ERERRAKVIHAEGELQASEKLLEAARMLAQQPEAIQLRYLQTLTQIAGDKSSTIVFPLPM EVLGAVKKATGA