Protein Info for ABZR87_RS09295 in Ralstonia sp. UNC404CL21Col

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 55 to 72 (18 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 223 to 251 (29 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 375 to 392 (18 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 444 to 467 (24 residues), see Phobius details amino acids 479 to 501 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 62% identity to bcj:BCAL2370)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>ABZR87_RS09295 glycosyl transferase (Ralstonia sp. UNC404CL21Col)
MQEPTRPGRRSAHAPAATTHARDFTAHPALLATGGVITPAAPSVRAWPWRVLRKWLLVAL
VACAYLLPGTLGHDPWKQDETYTFGIVQHMVATGDPIVPVNAGQPFVEKPPLYAWVASTL
VWLLADVLPAHDAARLASALFAGLALAFTARLARAATGAASWTDARVLGTVALSAGSLIV
VKHAHEMITDVALLAGTAIGFCGLFECVQPATRARGSAWLLGLGMGMALLAKGVFIPLVF
CITIAGAGVLLPACRSRVFARQLGTAALVFLPFATIWPTLFYLRAPDLFQVWFWDNNIGR
FLGFSVPVLGAENDDPFYVWHSLLTIGFPAGPLALVALARGAWRDWRTPHVALPLVFAAV
GLLALQVSATARPLYLLPFIVPLAMLGQRAMSRLPMRVHIAWDYLSRALFGGLVLLAWLL
WAVMTESTSHAGLRWLDRWLPVDWILPIQPTLVAAALALTVGWLWLLPRLKAAGVWRGAM
SWAAGALVGWGLIGTLLLPWLDEAKSYRSVFDSLGVKLAPAWRMDDCMASLHLGESEAPM
LRYFTGILHQPVGQSTAQHCRWLIVQDSHTHARTPGMEWTLFWSGARHGDRNERLRVFQR
ETAPPP